PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017397m
Common NameCARUB_v10017397mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 398aa    MW: 43464.6 Da    PI: 5.9068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017397mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-185499147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd  l ++v +lG ++W++Iar ++ gR++k+c++rw + 
  Carubv10017397m 54 KGPWSTEEDAVLTKLVSKLGARNWSLIARGIP-GRSGKSCRLRWCNQ 99
                     79******************************.***********985 PP

2Myb_DNA-binding50.35.5e-16106150147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd  ++ a++ +G++ W+ Ia+++  gRt++ +k++w++ 
  Carubv10017397m 106 RKPFSDEEDRMIISAHAIHGNK-WAVIAKMLS-GRTDNAIKNHWNST 150
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.69549104IPR017930Myb domain
SuperFamilySSF466893.09E-3051147IPR009057Homeodomain-like
SMARTSM007179.8E-1553102IPR001005SANT/Myb domain
PfamPF002491.5E-165499IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2655107IPR009057Homeodomain-like
CDDcd001671.28E-135698No hitNo description
PROSITE profilePS5129420.849105155IPR017930Myb domain
SMARTSM007174.0E-16105153IPR001005SANT/Myb domain
PfamPF002493.3E-14106150IPR001005SANT/Myb domain
CDDcd001677.78E-12108151No hitNo description
Gene3DG3DSA:1.10.10.602.5E-23108154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEGETHQSEP LPLPSGDSDE GISAAIEAEL AELAAGDSSG GGCGGGRGVK SKVKGPWSTE  60
EDAVLTKLVS KLGARNWSLI ARGIPGRSGK SCRLRWCNQL DPSLKRKPFS DEEDRMIISA  120
HAIHGNKWAV IAKMLSGRTD NAIKNHWNST LRRKYADLWN TGSQWIPNSV TTAHIKNENV  180
EEKQQLPQGE INSPPKNNSP PNPPQVSDVI MEDAANEPQE QAPPLDSNVP PVESNVPVDS  240
NVFRPVARVG AFSVYNPTSH RNGYRDHNIV PCEGLLIQAA KPDSLAGKFL QSLYDEPHVP  300
SKCGRGCSTN PAETKFSRNS VLGPEFVDYE EPCAVFNQEL ISIATDLNNL AWIKSGLDNA  360
VVREAEQSLK IDNFNYNDPR IKFSGMMPRQ DFFCARS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-38481541107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2627340.0AF262734.2 Arabidopsis thaliana putative transcription factor MYB109 (MYB109) mRNA, complete cds.
GenBankAY1363250.0AY136325.1 Arabidopsis thaliana MYB transcription factor-like protein (At3g55730) mRNA, complete cds.
GenBankBT0000920.0BT000092.1 Arabidopsis thaliana MYB transcription factor-like protein (At3g55730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291267.10.0hypothetical protein CARUB_v10017397mg
TrEMBLR0HGB70.0R0HGB7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1999__AT3G55730.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.10.0myb domain protein 109